Lineage for d4r0ja_ (4r0j A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955800Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (8 families) (S)
  5. 2955818Family d.58.53.2: CRISPR-associated protein Cas5d-like [345973] (2 proteins)
    Pfam PF09704. Contains several beta-sheet insertions to the common fold
  6. 2955825Protein automated matches [346098] (1 species)
    not a true protein
  7. 2955826Species Streptococcus mutans [TaxId:210007] [346365] (1 PDB entry)
  8. 2955827Domain d4r0ja_: 4r0j A: [345432]
    automated match to d3vzha_
    complexed with cl, so4

Details for d4r0ja_

PDB Entry: 4r0j (more details), 1.72 Å

PDB Description: The crystal structure of a functionally uncharacterized protein SMU1763c from Streptococcus mutans
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d4r0ja_:

Sequence, based on SEQRES records: (download)

>d4r0ja_ d.58.53.2 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}
nlyrsrnfyarirgdralftnpatkggserssysvptrqalqgiidgiyhkptftnvite
vkvvnqiqtelhgvrallhdysadlsyvsylsdveylvkfhfiwnenredliqdrlpkkh
eaimersirkggrrdiflgtrecfglvdeisqeeyetipsyyngvtidlgimfhsfaypt
skdtplksyftktvmengaikfkpqseceivnt

Sequence, based on observed residues (ATOM records): (download)

>d4r0ja_ d.58.53.2 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}
nlyrsrnfyarirgdralftnpatssysvptrqalqgiidgiyhkptftnvitevkvvnq
iqtelhgvrayvsylsdveylvkfhfiwnenredliqdrlpkkheaimersirkggrrdi
flgtrecfglvdeisqeeyetipsyyngvtidlgimfhsfaypdtplksyftktvmenga
ikfkpqseceivnt

SCOPe Domain Coordinates for d4r0ja_:

Click to download the PDB-style file with coordinates for d4r0ja_.
(The format of our PDB-style files is described here.)

Timeline for d4r0ja_: