SCOPe 2.08: Domain d4qrea2: 4qre A:360-520

Lineage for d4qrea2 (4qre A:360-520)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (13 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [346173] (2 PDB entries)

8. Domain d4qrea2: 4qre A:360-520 [345431]
   Other proteins in same PDB: d4qrea1
   automated match to d2ct8a2
   protein/RNA complex; complexed with 3bg, atp, mg

Details for d4qrea2

PDB Entry: 4qre, 1.7 Å

PDB Description: structure of methionyl-trna synthetase in complex with 1-(4-{4-[(1h- benzimidazol-2-ylmethyl)amino]-6-(4,5-dimethoxy-2-methylphenoxy) pyrimidin-2-yl}piperazin-1-yl)ethanone

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4qrea2:

Sequence; same for both SEQRES and ATOM records:

>d4qrea2 a.27.1.0 (A:360-520) automated matches {Staphylococcus aureus [TaxId: 1280]}
landlgnlvnrtismvnkyfdgelpayqgplheldeemeamaletvksytesmeslqfsv
alstvwkfisrtnkyidettpwvlakddsqkdmlgnvmahlveniryaavllrpflthap
keifeqlninnpqfmefssleqygvltesimvtgqpkpifp

Timeline for d4qrea2:

• d4qrea2 first appeared in SCOPe 2.07