Lineage for d4qrda1 (4qrd A:2-359)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469385Species Staphylococcus aureus [TaxId:1280] [189083] (3 PDB entries)
  8. 2469388Domain d4qrda1: 4qrd A:2-359 [345428]
    Other proteins in same PDB: d4qrda2
    automated match to d2ct8a1
    protein/RNA complex; complexed with 3bj, mg

Details for d4qrda1

PDB Entry: 4qrd (more details), 1.97 Å

PDB Description: structure of methionyl-trna synthetase in complex with n-(1h- benzimidazol-2-ylmethyl)-n'-(2,4-dichlorophenyl)-6-(morpholin-4-yl)- 1,3,5-triazine-2,4-diamine
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4qrda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qrda1 c.26.1.0 (A:2-359) automated matches {Staphylococcus aureus [TaxId: 1280]}
aketfyittpiyypsgnlhighaystvagdviarykrmqgydvryltgtdehgqkiqeka
qkagkteieyldemiagikqlwakleisnddfirtteerhkhvveqvferllkqgdiylg
eyegwysvpdetyytesqlvdpqyengkiiggkspdsghevelvkeesyffniskytdrl
lefydqnpdfiqppsrkneminnfikpgladlavsrtsfnwgvhvpsnpkhvvyvwidal
vnyisalgylsddeslfnkywpadihlmakeivrfhsiiwpillmaldlplpkkvfahgw
ilmkdgkmskskgnvvdpnilidrygldatryylmrelpfgsdgvftpeafvertnfd

SCOPe Domain Coordinates for d4qrda1:

Click to download the PDB-style file with coordinates for d4qrda1.
(The format of our PDB-style files is described here.)

Timeline for d4qrda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qrda2