Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (59 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [189083] (3 PDB entries) |
Domain d4qrda1: 4qrd A:2-359 [345428] Other proteins in same PDB: d4qrda2 automated match to d2ct8a1 protein/RNA complex; complexed with 3bj, mg |
PDB Entry: 4qrd (more details), 1.97 Å
SCOPe Domain Sequences for d4qrda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qrda1 c.26.1.0 (A:2-359) automated matches {Staphylococcus aureus [TaxId: 1280]} aketfyittpiyypsgnlhighaystvagdviarykrmqgydvryltgtdehgqkiqeka qkagkteieyldemiagikqlwakleisnddfirtteerhkhvveqvferllkqgdiylg eyegwysvpdetyytesqlvdpqyengkiiggkspdsghevelvkeesyffniskytdrl lefydqnpdfiqppsrkneminnfikpgladlavsrtsfnwgvhvpsnpkhvvyvwidal vnyisalgylsddeslfnkywpadihlmakeivrfhsiiwpillmaldlplpkkvfahgw ilmkdgkmskskgnvvdpnilidrygldatryylmrelpfgsdgvftpeafvertnfd
Timeline for d4qrda1: