SCOPe 2.07: Domain d4py2b2: 4py2 B:353-510

Lineage for d4py2b2 (4py2 B:353-510)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (13 species)
   not a true protein

7. Species Brucella melitensis [TaxId:359391] [346171] (2 PDB entries)

8. Domain d4py2b2: 4py2 B:353-510 [345415]
   Other proteins in same PDB: d4py2a1, d4py2b1, d4py2c1
   automated match to d2x1la2
   protein/RNA complex; complexed with 43e, edo

Details for d4py2b2

PDB Entry: 4py2, 2.15 Å

PDB Description: crystal structure of methionyl-trna synthetase metrs from brucella melitensis in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl) amino]propyl}-3-thiophen-3-ylurea

PDB Compounds: (B:) Methionine--tRNA ligase

SCOPe Domain Sequences for d4py2b2:

Sequence; same for both SEQRES and ATOM records:

>d4py2b2 a.27.1.0 (B:353-510) automated matches {Brucella melitensis [TaxId: 359391]}
andlgnlaqrslsmiakncegkvpqpgafseadkaildqadaaletarkamddqalhlal
gaifavvaeanryfagqepwalrktdparmgtvlyvtaevlrrvgimvqpfipqsaekll
dilavpadkrqfadvlasplaggtdlpapqpvfpryve

Timeline for d4py2b2:

• d4py2b2 is new in SCOPe 2.07-stable
  
• d4py2b2 appears in the current release, SCOPe 2.08