Lineage for d4py2a1 (4py2 A:3-352)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (52 species)
    not a true protein
  7. 2443183Species Brucella melitensis [TaxId:359391] [346283] (2 PDB entries)
  8. 2443184Domain d4py2a1: 4py2 A:3-352 [345412]
    Other proteins in same PDB: d4py2a2, d4py2b2, d4py2c2
    automated match to d2x1la1
    protein/RNA complex; complexed with 43e, edo

Details for d4py2a1

PDB Entry: 4py2 (more details), 2.15 Å

PDB Description: crystal structure of methionyl-trna synthetase metrs from brucella melitensis in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl) amino]propyl}-3-thiophen-3-ylurea
PDB Compounds: (A:) Methionine--tRNA ligase

SCOPe Domain Sequences for d4py2a1:

Sequence, based on SEQRES records: (download)

>d4py2a1 c.26.1.0 (A:3-352) automated matches {Brucella melitensis [TaxId: 359391]}
rekyyittaiaypngkphighayeliatdamarfqrlngmdvyfltgtdehgikmlqsar
kegitprdladrntsafrrmaevlnssnddyirtseerhykasqaiwqamvangdiykgg
yagwysvrdeayygeeetevradgvrygpqgtpvewveeesyffrlsayqdklldlyenn
pgfimpaerrneivsfvksglkdlsisrttfdwgipvpgdekhvmyvwvdaltnyitalg
ypdttderwaywpanahiigkdisrfhavywpaflmsaqlplpkrvfahgflfnrgekms
ksvgnvidpfelverygldqlryflmrevpfgqdgsysheaivnrtnadl

Sequence, based on observed residues (ATOM records): (download)

>d4py2a1 c.26.1.0 (A:3-352) automated matches {Brucella melitensis [TaxId: 359391]}
rekyyittaiaypngkphighayeliatdamarfqrlngmdvyfltgtdehgikmlqsar
kegitprdladrntsafrrmaevlnssnddyirtseerhykasqaiwqamvangdiykgg
yagwysvrdeayygeeetevradgvrygpqgtpvewveeesyffrlsayqdklldlyenn
pgfimpaerrneivsfvksglkdlsisrttfdwgipvpgdekhvmyvwvdaltnyitalg
ypdttderwaywpanahiigkdisrfhavywpaflmsaqlplpkrvfahgflfnridpfe
lverygldqlryflmrevpfgqdgsysheaivnrtnadl

SCOPe Domain Coordinates for d4py2a1:

Click to download the PDB-style file with coordinates for d4py2a1.
(The format of our PDB-style files is described here.)

Timeline for d4py2a1:

  • d4py2a1 is new in SCOPe 2.07-stable