Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.7: LysM domain [54105] (1 superfamily) beta-alpha(2)-beta; antiparallel strands |
Superfamily d.7.1: LysM domain [54106] (2 families) automatically mapped to Pfam PF01476 |
Family d.7.1.0: automated matches [234000] (1 protein) not a true family |
Protein automated matches [234001] (7 species) not a true protein |
Species Pteris ryukyuensis [TaxId:367335] [346349] (2 PDB entries) |
Domain d4pxvd_: 4pxv D: [345411] automated match to d5k2la_ complexed with zn |
PDB Entry: 4pxv (more details), 1.8 Å
SCOPe Domain Sequences for d4pxvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pxvd_ d.7.1.0 (D:) automated matches {Pteris ryukyuensis [TaxId: 367335]} cttytiksgdtcyaisqargislsdfeswnagidcnnlqigqvvcvs
Timeline for d4pxvd_: