SCOPe 2.08: Domain d4pxva_: 4pxv A:

Lineage for d4pxva_ (4pxv A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.7: LysM domain [54105] (1 superfamily)
   beta-alpha(2)-beta; antiparallel strands

4. Superfamily d.7.1: LysM domain [54106] (2 families)
   automatically mapped to Pfam PF01476

5. Family d.7.1.0: automated matches [234000] (1 protein)
   not a true family

6. Protein automated matches [234001] (7 species)
   not a true protein

7. Species Pteris ryukyuensis [TaxId:367335] [346349] (2 PDB entries)

8. Domain d4pxva_: 4pxv A: [345408]
   automated match to d5k2la_
   complexed with zn

Details for d4pxva_

PDB Entry: 4pxv, 1.8 Å

PDB Description: crystal structure of lysm domain from pteris ryukyuensis chitinase a

PDB Compounds: (A:) chitinase a

SCOPe Domain Sequences for d4pxva_:

Sequence; same for both SEQRES and ATOM records:

>d4pxva_ d.7.1.0 (A:) automated matches {Pteris ryukyuensis [TaxId: 367335]}
cttytiksgdtcyaisqargislsdfeswnagidcnnlqigqvvcvs

Timeline for d4pxva_:

• d4pxva_ first appeared in SCOPe 2.07