Lineage for d4ppva_ (4ppv A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338437Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2338438Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2338501Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. 2338502Protein automated matches [237402] (6 species)
    not a true protein
  7. 2338529Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346214] (2 PDB entries)
  8. 2338531Domain d4ppva_: 4ppv A: [345407]
    automated match to d5w6yb_
    complexed with phe

Details for d4ppva_

PDB Entry: 4ppv (more details), 2.45 Å

PDB Description: Crystal Structure of AtCM1 with Phenylalanine Bound in Allosteric Site
PDB Compounds: (A:) Chorismate mutase 1, chloroplastic

SCOPe Domain Sequences for d4ppva_:

Sequence, based on SEQRES records: (download)

>d4ppva_ a.130.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rvdesesltlegirnslirqedsiifgllerakycynadtydptafdmdgfngslveymv
kgteklhakvgrfkspdehpffpddlpepmlpplqypkvlhfaadsininkkiwnmyfrd
lvprlvkkgddgnygstavcdaiclqclskrihygkfvaeakfqaspeayesaikaqdkd
almdmltfptvedaikkrvemktrtygqevkvgmeekeeeeeegneshvykispilvgdl
ygdwimpltkevqveyllrrld

Sequence, based on observed residues (ATOM records): (download)

>d4ppva_ a.130.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rvdesesltlegirnslirqedsiifgllerakycynadtydptafdmdgfngslveymv
kgteklhakvgrfkspdehpffpddlpepmlpplqypkvlhfaadsininkkiwnmyfrd
lvprlvkkgddgnygstavcdaiclqclskrihygkfvaeakfqaspeayesaikaqdkd
almdmltfptvedaikkrvemktrtygqevkvvykispilvgdlygdwimpltkevqvey
llrrld

SCOPe Domain Coordinates for d4ppva_:

Click to download the PDB-style file with coordinates for d4ppva_.
(The format of our PDB-style files is described here.)

Timeline for d4ppva_:

  • d4ppva_ is new in SCOPe 2.07-stable