| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
| Family b.34.13.0: automated matches [191621] (1 protein) not a true family |
| Protein automated matches [191139] (6 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346228] (2 PDB entries) |
| Domain d4plla_: 4pll A: [345396] automated match to d5in1a_ |
PDB Entry: 4pll (more details), 2.6 Å
SCOPe Domain Sequences for d4plla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4plla_ b.34.13.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hfeegervlakhsdcfyeakvlkvefkdnewkyfvhyigwnkswdewirldcllkh
Timeline for d4plla_: