SCOPe 2.08: Domain d4plla_: 4pll A:

Lineage for d4plla_ (4pll A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.0: automated matches [191621] (1 protein)
   not a true family

6. Protein automated matches [191139] (6 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346228] (2 PDB entries)

8. Domain d4plla_: 4pll A: [345396]
   automated match to d5in1a_

Details for d4plla_

PDB Entry: 4pll, 2.6 Å

PDB Description: structure of the chromodaomain of mrg2 in complex with h3k36me3

PDB Compounds: (A:) At1g02740

SCOPe Domain Sequences for d4plla_:

Sequence; same for both SEQRES and ATOM records:

>d4plla_ b.34.13.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hfeegervlakhsdcfyeakvlkvefkdnewkyfvhyigwnkswdewirldcllkh

Timeline for d4plla_:

• d4plla_ first appeared in SCOPe 2.07