Lineage for d4plia_ (4pli A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785217Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 2785218Protein automated matches [191139] (6 species)
    not a true protein
  7. 2785255Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346228] (2 PDB entries)
  8. 2785256Domain d4plia_: 4pli A: [345394]
    automated match to d5in1a_

Details for d4plia_

PDB Entry: 4pli (more details), 1.65 Å

PDB Description: structure of the chromodomain of mrg2 in complex with h3k36me3
PDB Compounds: (A:) At1g02740

SCOPe Domain Sequences for d4plia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4plia_ b.34.13.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hfeegervlakhsdcfyeakvlkvefkdnewkyfvhyigwnkswdewirldcllkhs

SCOPe Domain Coordinates for d4plia_:

Click to download the PDB-style file with coordinates for d4plia_.
(The format of our PDB-style files is described here.)

Timeline for d4plia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4plib_