Lineage for d4pj3a2 (4pj3 A:19-415)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2333288Family a.118.1.29: Pre-mRNA splicing factor Cwf11 N-terminal domain-like [345955] (1 protein)
    N-terminal part of Pfam PF16399; contains ARM repeats and several extra helices
  6. 2333289Protein Pre-mRNA splicing factor Cwf11 / Aquarius [346026] (2 species)
  7. 2333290Species Human (Homo sapiens) [TaxId:9606] [346186] (1 PDB entry)
  8. 2333291Domain d4pj3a2: 4pj3 A:19-415 [345391]
    Other proteins in same PDB: d4pj3a1, d4pj3a3, d4pj3a4
    protein/RNA complex; complexed with anp, mg

Details for d4pj3a2

PDB Entry: 4pj3 (more details), 2.3 Å

PDB Description: structural insight into the function and evolution of the spliceosomal helicase aquarius, structure of aquarius in complex with amppnp
PDB Compounds: (A:) Intron-binding protein aquarius

SCOPe Domain Sequences for d4pj3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj3a2 a.118.1.29 (A:19-415) Pre-mRNA splicing factor Cwf11 / Aquarius {Human (Homo sapiens) [TaxId: 9606]}
naefvtqlackywaphikkkspfdikviediyekeivksrfairkimllefsqylenylw
mnyspevsskaylmsiccmvnekfrenvpaweifkkkpdhfpfffkhilkaalaetdgef
slheqtvlllfldhcfnslevdlirsqvqqlislpmwmglqlarlelelkktpklrkfwn
likkndekmdpeareqayqerrflsqliqkfisvlksvplsepvtmdkvhycerfielmi
dleallptrrwfntilddshllvhcylsnlvrreedghlfsqlldmlkfytgfeindqtg
naltenemttihydritslqraafahfpelydfalsnvaevdtreslvkffgplssntlh
qvasylcllptlpknedttfdkefllellvsrherri

SCOPe Domain Coordinates for d4pj3a2:

Click to download the PDB-style file with coordinates for d4pj3a2.
(The format of our PDB-style files is described here.)

Timeline for d4pj3a2:

  • d4pj3a2 is new in SCOPe 2.07-stable