Lineage for d4oo8d2 (4oo8 D:59-713)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2618005Fold d.393: CRISPR-associated endonuclease Cas9/Csn1, Target recognition (REC) lobe [345890] (1 superfamily)
    Mostly helical, complex structure
  4. 2618006Superfamily d.393.1: CRISPR-associated endonuclease Cas9/Csn1, Target recognition (REC) lobe [345923] (1 family) (S)
    Pfam PF16593, Pfam PF13395
  5. 2618007Family d.393.1.1: CRISPR-associated endonuclease Cas9/Csn1, Target recognition (REC) lobe [345978] (1 protein)
  6. 2618008Protein CRISPR-associated endonuclease Cas9/Csn1, REC lobe [346112] (3 species)
  7. 2618013Species Streptococcus pyogenes [TaxId:301447] [346402] (2 PDB entries)
  8. 2618015Domain d4oo8d2: 4oo8 D:59-713 [345384]
    Other proteins in same PDB: d4oo8a1, d4oo8a2, d4oo8a4, d4oo8d1, d4oo8d3
    automated match to d4oo8a3
    protein/DNA complex; protein/RNA complex

Details for d4oo8d2

PDB Entry: 4oo8 (more details), 2.5 Å

PDB Description: crystal structure of streptococcus pyogenes cas9 in complex with guide rna and target dna
PDB Compounds: (D:) crispr-associated endonuclease cas9/csn1

SCOPe Domain Sequences for d4oo8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oo8d2 d.393.1.1 (D:59-713) CRISPR-associated endonuclease Cas9/Csn1, REC lobe {Streptococcus pyogenes [TaxId: 301447]}
aeatrlkrtarrrytrrknrilylqeifsnemakvddsffhrleesflveedkkherhpi
fgnivdevayhekyptiyhlrkklvdstdkadlrliylalahmikfrghfliegdlnpdn
sdvdklfiqlvqtynqlfeenpinasgvdakailsarlsksrrlenliaqlpgekknglf
gnlialslgltpnfksnfdlaedaklqlskdtydddldnllaqigdqyadlflaaknlsd
aillsdilrvnteitkaplsasmikrydehhqdltllkalvrqqlpekykeiffdqskng
yagyidggasqeefykfikpilekmdgteellvklnredllrkqrtfdngsiphqihlge
lhailrrqedfypflkdnrekiekiltfripyyvgplargnsrfawmtrkseetitpwnf
eevvdkgasaqsfiermtnfdknlpnekvlpkhsllyeyftvyneltkvkyvtegmrkpa
flsgeqkkaivdllfktnrkvtvkqlkedyfkkieefdsveisgvedrfnaslgtyhdll
kiikdkdfldneenediledivltltlfedremieerlktyahlfddkvmkqlkrrrytg
wgrlsrklingirdkqsgktildflksdgfanrnfmqlihddsltfkediqkaqv

SCOPe Domain Coordinates for d4oo8d2:

Click to download the PDB-style file with coordinates for d4oo8d2.
(The format of our PDB-style files is described here.)

Timeline for d4oo8d2: