Lineage for d4oo8d1 (4oo8 D:3-58,D:718-765,D:919-1102)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495021Family c.55.3.16: RuvC-like domain from CRISPR-associated protein Cas9 [345969] (1 protein)
    Homology to RuvC noted in PubMed 21756346
  6. 2495022Protein CRISPR-associated endonuclease Cas9/Csn1, RuvC-like domain [346086] (3 species)
  7. 2495027Species Streptococcus pyogenes [TaxId:301447] [346314] (2 PDB entries)
  8. 2495029Domain d4oo8d1: 4oo8 D:3-58,D:718-765,D:919-1102 [345383]
    Other proteins in same PDB: d4oo8a2, d4oo8a3, d4oo8a4, d4oo8d2, d4oo8d3
    automated match to d4oo8a1
    protein/DNA complex; protein/RNA complex

Details for d4oo8d1

PDB Entry: 4oo8 (more details), 2.5 Å

PDB Description: crystal structure of streptococcus pyogenes cas9 in complex with guide rna and target dna
PDB Compounds: (D:) crispr-associated endonuclease cas9/csn1

SCOPe Domain Sequences for d4oo8d1:

Sequence, based on SEQRES records: (download)

>d4oo8d1 c.55.3.16 (D:3-58,D:718-765,D:919-1102) CRISPR-associated endonuclease Cas9/Csn1, RuvC-like domain {Streptococcus pyogenes [TaxId: 301447]}
kkysiglaigtnsvgwavitdeykvpskkfkvlgntdrhsikknligallfdsgetXdsl
hehianlagspaikkgilqtvkvvdelvkvmgrhkpeniviemarXrqlvetrqitkhva
qildsrmntkydendklirevkvitlksklvsdfrkdfqfykvreinnyhhahdaylnav
vgtalikkypklesefvygdykvydvrkmiakseqeigkatakyffysnimnffkteitl
angeirkrplietngetgeivwdkgrdfatvrkvlsmpqvnivkktevqt

Sequence, based on observed residues (ATOM records): (download)

>d4oo8d1 c.55.3.16 (D:3-58,D:718-765,D:919-1102) CRISPR-associated endonuclease Cas9/Csn1, RuvC-like domain {Streptococcus pyogenes [TaxId: 301447]}
kkysiglaigtnsvgwavitdeykvpskkfkvlgntdrhsikknligallfdsgetXdsl
hehianlagspaikkgilqtvkvvdelvkvmgrhkpeniviemarXrqlvetrqitkhva
qildsrmntkydendklirevkvitlksklvsdfrkdfqfykvreinnyhhahdaylnav
vgtalikkypklesefvygdfysnimnffklietngetgeivwdkgrdfatvrkvlsmpq
vnivkktevqt

SCOPe Domain Coordinates for d4oo8d1:

Click to download the PDB-style file with coordinates for d4oo8d1.
(The format of our PDB-style files is described here.)

Timeline for d4oo8d1: