Lineage for d4oo8a4 (4oo8 A:1103-1366)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2626563Fold e.80: CRISPR-associated endonuclease Cas9/Csn1, Protospace-adjacent motif (PAM)-interacting domain [345893] (1 superfamily)
    N-terminal part is structurally divergent wedge domain; middle domain is homologous to DNA gyrase B and Topoisomerase II; C-terminal domain appears to be Cas9-specific
  4. 2626564Superfamily e.80.1: CRISPR-associated endonuclease Cas9/Csn1, PAM-interacting (PI) domain [345926] (1 family) (S)
    Pfam PF16595
  5. 2626565Family e.80.1.1: CRISPR-associated endonuclease Cas9/Csn1, PAM-interacting (PI) domain [345982] (1 protein)
  6. 2626566Protein CRISPR-associated endonuclease Cas9/Csn1, PI domain [346119] (3 species)
  7. 2626571Species Streptococcus pyogenes [TaxId:301447] [346418] (2 PDB entries)
  8. 2626572Domain d4oo8a4: 4oo8 A:1103-1366 [345382]
    Other proteins in same PDB: d4oo8a1, d4oo8a2, d4oo8a3, d4oo8d1, d4oo8d2
    protein/DNA complex; protein/RNA complex

Details for d4oo8a4

PDB Entry: 4oo8 (more details), 2.5 Å

PDB Description: crystal structure of streptococcus pyogenes cas9 in complex with guide rna and target dna
PDB Compounds: (A:) crispr-associated endonuclease cas9/csn1

SCOPe Domain Sequences for d4oo8a4:

Sequence, based on SEQRES records: (download)

>d4oo8a4 e.80.1.1 (A:1103-1366) CRISPR-associated endonuclease Cas9/Csn1, PI domain {Streptococcus pyogenes [TaxId: 301447]}
ggfskesilpkrnsdkliarkkdwdpkkyggfdsptvaysvlvvakvekgkskklksvke
llgitimerssfeknpidfleakgykevkkdliiklpkyslfelengrkrmlasagelqk
gnelalpskyvnflylashyeklkgspedneqkqlfveqhkhyldeiieqisefskrvil
adanldkvlsaynkhrdkpireqaeniihlftltnlgapaafkyfdttidrkrytstkev
ldatlihqsitglyetridlsqlg

Sequence, based on observed residues (ATOM records): (download)

>d4oo8a4 e.80.1.1 (A:1103-1366) CRISPR-associated endonuclease Cas9/Csn1, PI domain {Streptococcus pyogenes [TaxId: 301447]}
ggfskesilpkrnsdkliarkkdwdpkkyggfdsptvaysvlvvakvekgkskklksvke
llgitimerssfeknpidfleakgykevkkdliiklpkyslfelengrkrmlasagelqk
gnelalpskyvnflylashypedneqkqlfveqhkhyldeiieqisefskrviladanld
kvlsaynkhrdkpireqaeniihlftltnlgapaafkyfdttidrkrytstkevldatli
hqsitglyetridlsqlg

SCOPe Domain Coordinates for d4oo8a4:

Click to download the PDB-style file with coordinates for d4oo8a4.
(The format of our PDB-style files is described here.)

Timeline for d4oo8a4: