SCOPe 2.08: Domain d4ogca4: 4ogc A:822-1101

Lineage for d4ogca4 (4ogc A:822-1101)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.80: CRISPR-associated endonuclease Cas9/Csn1, Protospace-adjacent motif (PAM)-interacting domain [345893] (1 superfamily)
   N-terminal part is structurally divergent wedge domain; middle domain is homologous to DNA gyrase B and Topoisomerase II; C-terminal domain appears to be Cas9-specific

4. Superfamily e.80.1: CRISPR-associated endonuclease Cas9/Csn1, PAM-interacting (PI) domain [345926] (1 family)
   Pfam PF16595

5. Family e.80.1.1: CRISPR-associated endonuclease Cas9/Csn1, PAM-interacting (PI) domain [345982] (1 protein)

6. Protein CRISPR-associated endonuclease Cas9/Csn1, PI domain [346119] (3 species)

7. Species Actinomyces naeslundii [TaxId:1115803] [346416] (1 PDB entry)

8. Domain d4ogca4: 4ogc A:822-1101 [345374]
   Other proteins in same PDB: d4ogca1, d4ogca2, d4ogca3
   complexed with act, mg, mn, spd, zn

Details for d4ogca4

PDB Entry: 4ogc, 2.8 Å

PDB Description: Crystal structure of the Type II-C Cas9 enzyme from Actinomyces naeslundii

PDB Compounds: (A:) HNH endonuclease domain protein

SCOPe Domain Sequences for d4ogca4:

Sequence; same for both SEQRES and ATOM records:

>d4ogca4 e.80.1.1 (A:822-1101) CRISPR-associated endonuclease Cas9/Csn1, PI domain {Actinomyces naeslundii [TaxId: 1115803]}
dgnahtvnpsklvshrlgdgltvqqidractpalwcaltrekdfdeknglparedrairv
hgheikssdyiqvfskrkktdsdrdetpfgaiavrggfveigpsihhariyrvegkkpvy
amlrvfthdllsqrhgdlfsavippqsismrcaepklrkaittgnatylgwvvvgdelei
nvdsftkyaigrfledfpnttrwricgydtnskltlkpivlaaeglenpssavneivelk
gwrvainvltkvhptvvrrdalgrpryssrsnlptswtie

Timeline for d4ogca4:

• d4ogca4 first appeared in SCOPe 2.07