Lineage for d4ogca3 (4ogc A:253-467)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012233Fold d.393: CRISPR-associated endonuclease Cas9/Csn1, Target recognition (REC) lobe [345890] (1 superfamily)
    Mostly helical, complex structure
  4. 3012234Superfamily d.393.1: CRISPR-associated endonuclease Cas9/Csn1, Target recognition (REC) lobe [345923] (1 family) (S)
    Pfam PF16593, Pfam PF13395
  5. 3012235Family d.393.1.1: CRISPR-associated endonuclease Cas9/Csn1, Target recognition (REC) lobe [345978] (1 protein)
  6. 3012236Protein CRISPR-associated endonuclease Cas9/Csn1, REC lobe [346112] (3 species)
  7. 3012237Species Actinomyces naeslundii [TaxId:1115803] [346400] (1 PDB entry)
  8. 3012238Domain d4ogca3: 4ogc A:253-467 [345373]
    Other proteins in same PDB: d4ogca1, d4ogca2, d4ogca4
    partly disordered
    complexed with act, mg, mn, spd, zn

    fragment; missing more than one-third of the common structure and/or sequence

Details for d4ogca3

PDB Entry: 4ogc (more details), 2.8 Å

PDB Description: Crystal structure of the Type II-C Cas9 enzyme from Actinomyces naeslundii
PDB Compounds: (A:) HNH endonuclease domain protein

SCOPe Domain Sequences for d4ogca3:

Sequence, based on SEQRES records: (download)

>d4ogca3 d.393.1.1 (A:253-467) CRISPR-associated endonuclease Cas9/Csn1, REC lobe {Actinomyces naeslundii [TaxId: 1115803]}
gsavsrvapdplpgqgsfrrapkcdpefqrfriisivanlrisetkgenrpltaderrhv
vtfltedsqadltwvdvaeklgvhrrdlrgtavhtddgersaarppidatdrimrqtkis
slktwweeadseqrgamirylyedptdsecaeiiaelpeedqakldslhlpagraaysre
sltalsdhmlattddlhearkrlfgvddswappae

Sequence, based on observed residues (ATOM records): (download)

>d4ogca3 d.393.1.1 (A:253-467) CRISPR-associated endonuclease Cas9/Csn1, REC lobe {Actinomyces naeslundii [TaxId: 1115803]}
gsavsrvapdplpgqgsfrrapkcdpefqrfriisivanlrisetkgenrpltaderrhv
vtfltedsqadltwvdvaeklgvhrrdlrgtrsaarppidatdrimrqtkisslktwwee
adseqrgamirylyedptdsecaeiiaelpeedqakldslhlpagraaysresltalsdh
mlattddlhearkrlfgvddswappae

SCOPe Domain Coordinates for d4ogca3:

Click to download the PDB-style file with coordinates for d4ogca3.
(The format of our PDB-style files is described here.)

Timeline for d4ogca3: