![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
![]() | Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) ![]() common motif contains conserved histidine residue and metal-binding site |
![]() | Family d.4.1.8: HNH domain from CRISPR-associated protein Cas9 [345970] (1 protein) Homology to HNH nucleases noted in PubMed 21756346 Pfam PF13395 |
![]() | Protein CRISPR-associated endonuclease Cas9/Csn1, HNH domain [346090] (3 species) |
![]() | Species Actinomyces naeslundii [TaxId:1115803] [346346] (1 PDB entry) |
![]() | Domain d4ogca2: 4ogc A:513-673 [345372] Other proteins in same PDB: d4ogca1, d4ogca3, d4ogca4 complexed with act, mg, mn, spd, zn |
PDB Entry: 4ogc (more details), 2.8 Å
SCOPe Domain Sequences for d4ogca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ogca2 d.4.1.8 (A:513-673) CRISPR-associated endonuclease Cas9/Csn1, HNH domain {Actinomyces naeslundii [TaxId: 1115803]} sermaderdkanrrryndnqeamkkiqrdygkegyisrgdivrldalelqgcaclycgtt igyhtcqldhivpqagpgsnnrrgnlvavcercnrsksntpfavwaqkcgiphvgvkeai grvrgwrkqtpntssedltrlkkeviarlrrtqedpeider
Timeline for d4ogca2: