Lineage for d4ogca2 (4ogc A:513-673)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2927847Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2927848Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2927990Family d.4.1.8: HNH domain from CRISPR-associated protein Cas9 [345970] (1 protein)
    Homology to HNH nucleases noted in PubMed 21756346
    Pfam PF13395
  6. 2927991Protein CRISPR-associated endonuclease Cas9/Csn1, HNH domain [346090] (3 species)
  7. 2927992Species Actinomyces naeslundii [TaxId:1115803] [346346] (1 PDB entry)
  8. 2927993Domain d4ogca2: 4ogc A:513-673 [345372]
    Other proteins in same PDB: d4ogca1, d4ogca3, d4ogca4
    complexed with act, mg, mn, spd, zn

Details for d4ogca2

PDB Entry: 4ogc (more details), 2.8 Å

PDB Description: Crystal structure of the Type II-C Cas9 enzyme from Actinomyces naeslundii
PDB Compounds: (A:) HNH endonuclease domain protein

SCOPe Domain Sequences for d4ogca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ogca2 d.4.1.8 (A:513-673) CRISPR-associated endonuclease Cas9/Csn1, HNH domain {Actinomyces naeslundii [TaxId: 1115803]}
sermaderdkanrrryndnqeamkkiqrdygkegyisrgdivrldalelqgcaclycgtt
igyhtcqldhivpqagpgsnnrrgnlvavcercnrsksntpfavwaqkcgiphvgvkeai
grvrgwrkqtpntssedltrlkkeviarlrrtqedpeider

SCOPe Domain Coordinates for d4ogca2:

Click to download the PDB-style file with coordinates for d4ogca2.
(The format of our PDB-style files is described here.)

Timeline for d4ogca2: