SCOPe 2.08: Domain d4ogca1: 4ogc A:8-49,A:468-512,A:674-821

Lineage for d4ogca1 (4ogc A:8-49,A:468-512,A:674-821)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.16: RuvC-like domain from CRISPR-associated protein Cas9 [345969] (1 protein)
   Homology to RuvC noted in PubMed 21756346
   Pfam PF18541

6. Protein CRISPR-associated endonuclease Cas9/Csn1, RuvC-like domain [346086] (3 species)

7. Species Actinomyces naeslundii [TaxId:1115803] [346312] (1 PDB entry)

8. Domain d4ogca1: 4ogc A:8-49,A:468-512,A:674-821 [345371]
   Other proteins in same PDB: d4ogca2, d4ogca3, d4ogca4
   complexed with act, mg, mn, spd, zn

Details for d4ogca1

PDB Entry: 4ogc, 2.8 Å

PDB Description: Crystal structure of the Type II-C Cas9 enzyme from Actinomyces naeslundii

PDB Compounds: (A:) HNH endonuclease domain protein

SCOPe Domain Sequences for d4ogca1:

Sequence; same for both SEQRES and ATOM records:

>d4ogca1 c.55.3.16 (A:8-49,A:468-512,A:674-821) CRISPR-associated endonuclease Cas9/Csn1, RuvC-like domain {Actinomyces naeslundii [TaxId: 1115803]}
sahhlrvgidvgthsvglatlrvddhgtpiellsalshihdsXainapvgnpsvdrtlki
vgrylsavesmwgtpevihvehvrdgftXsmesvawmanelhhriaaaypettvmvyrgs
itaaarkaagidsrinligekgrkdridrrhhavdasvvalmeasvaktlaersslrgeq
rltgkeqtwkqytgstvgarehfemwrghmlhltelfnerlaedkvyvtqnirlrls

Timeline for d4ogca1:

• d4ogca1 first appeared in SCOPe 2.07