Lineage for d4ogca1 (4ogc A:8-49,A:468-512,A:674-821)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887197Family c.55.3.16: RuvC-like domain from CRISPR-associated protein Cas9 [345969] (1 protein)
    Homology to RuvC noted in PubMed 21756346
    Pfam PF18541
  6. 2887198Protein CRISPR-associated endonuclease Cas9/Csn1, RuvC-like domain [346086] (3 species)
  7. 2887199Species Actinomyces naeslundii [TaxId:1115803] [346312] (1 PDB entry)
  8. 2887200Domain d4ogca1: 4ogc A:8-49,A:468-512,A:674-821 [345371]
    Other proteins in same PDB: d4ogca2, d4ogca3, d4ogca4
    complexed with act, mg, mn, spd, zn

Details for d4ogca1

PDB Entry: 4ogc (more details), 2.8 Å

PDB Description: Crystal structure of the Type II-C Cas9 enzyme from Actinomyces naeslundii
PDB Compounds: (A:) HNH endonuclease domain protein

SCOPe Domain Sequences for d4ogca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ogca1 c.55.3.16 (A:8-49,A:468-512,A:674-821) CRISPR-associated endonuclease Cas9/Csn1, RuvC-like domain {Actinomyces naeslundii [TaxId: 1115803]}
sahhlrvgidvgthsvglatlrvddhgtpiellsalshihdsXainapvgnpsvdrtlki
vgrylsavesmwgtpevihvehvrdgftXsmesvawmanelhhriaaaypettvmvyrgs
itaaarkaagidsrinligekgrkdridrrhhavdasvvalmeasvaktlaersslrgeq
rltgkeqtwkqytgstvgarehfemwrghmlhltelfnerlaedkvyvtqnirlrls

SCOPe Domain Coordinates for d4ogca1:

Click to download the PDB-style file with coordinates for d4ogca1.
(The format of our PDB-style files is described here.)

Timeline for d4ogca1: