Lineage for d4ofga_ (4ofg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816902Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2816903Protein automated matches [226927] (20 species)
    not a true protein
  7. 2816965Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [311407] (3 PDB entries)
  8. 2816968Domain d4ofga_: 4ofg A: [345370]
    automated match to d5kjxa_
    complexed with eoh, n2p, pcg, so4

Details for d4ofga_

PDB Entry: 4ofg (more details), 2 Å

PDB Description: Co-crystal structure of carboxy cGMP binding domain of Plasmodium falciparum PKG with cGMP
PDB Compounds: (A:) CGMP-dependent protein kinase

SCOPe Domain Sequences for d4ofga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ofga_ b.82.3.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
dasidynnkksiikkmyifryltdkqcnllieafrttryeegdyiiqegevgsrfyiikn
geveivknkkrlrtlgkndyfgerallydeprtasviskvnnvecwfvdksvflqiiqgp
mlahleerikmqdtkvemdele

SCOPe Domain Coordinates for d4ofga_:

Click to download the PDB-style file with coordinates for d4ofga_.
(The format of our PDB-style files is described here.)

Timeline for d4ofga_: