Lineage for d4nicd_ (4nic D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464267Species Klebsiella pneumoniae [TaxId:573] [225322] (2 PDB entries)
  8. 2464273Domain d4nicd_: 4nic D: [345365]
    automated match to d5dcla_
    complexed with bef, mg

Details for d4nicd_

PDB Entry: 4nic (more details), 3.18 Å

PDB Description: Crystal structure of Klebsiella pneumoniae RstA BeF3-activated N-terminal receiver domain
PDB Compounds: (D:) DNA-binding transcriptional regulator RstA

SCOPe Domain Sequences for d4nicd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nicd_ c.23.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
nkivfveddpevgtliaaylgkhdmdvvveprgdraeeviarekpdlvlldimlpgkdgm
tlcrdlrgqwqgpivlltsldsdmnhilslemgasdyilkttppavllarlrlhlrq

SCOPe Domain Coordinates for d4nicd_:

Click to download the PDB-style file with coordinates for d4nicd_.
(The format of our PDB-style files is described here.)

Timeline for d4nicd_: