Lineage for d4mx2d_ (4mx2 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337216Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2337217Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2337388Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2337389Protein automated matches [190621] (25 species)
    not a true protein
  7. 2337449Species Leishmania donovani [TaxId:5661] [346211] (1 PDB entry)
  8. 2337453Domain d4mx2d_: 4mx2 D: [345357]
    automated match to d4efca_
    complexed with amp, gol, so4

Details for d4mx2d_

PDB Entry: 4mx2 (more details), 1.9 Å

PDB Description: Crystal Structure of adenylosuccinate lyase from Leishmania donovani
PDB Compounds: (D:) adenylosuccinate lyase

SCOPe Domain Sequences for d4mx2d_:

Sequence, based on SEQRES records: (download)

>d4mx2d_ a.127.1.0 (D:) automated matches {Leishmania donovani [TaxId: 5661]}
eisqdsplyslspldgrykrdttplrayfseyalfkyrvqvevlyfealckevpaitqlr
gvtdaqlgelrattfenfavddakiikgieavtnhdikaveyylkdkmsacgleaekefi
hfgltsqdinntsipmllrdalhhhyiptldqliallksklpewdvpmlarthgqpaspt
nlakefmvwierleeqrtmllsipntgkfggatgnfnahlcaypgvnwldfgelflskyl
glrrqryttqiehydnlaaicdacarlhtilmdlakdvwqyislgyfdqkvragevgssa
mphkvnpidfenaegnlgmsnavlgflsaklpisrlqrdltdstvlrnlgvplshaliaf
aslrrgidklllnkdviasdlegnwavvaegiqtvlrregypkpyealkdltrgnahvte
etvhrfvqqlegiteevrqellaitpftyvgytahp

Sequence, based on observed residues (ATOM records): (download)

>d4mx2d_ a.127.1.0 (D:) automated matches {Leishmania donovani [TaxId: 5661]}
eisqdsplyslspldgrykrdttplrayfseyalfkyrvqvevlyfealckevpaitqlr
gvtdaqlgelrattfenfavddakiikgieavtnhdikaveyylkdkmsacgleaekefi
hfgltsqdinntsipmllrdalhhhyiptldqliallksklpewdvpmlarthgqpaspt
nlakefmvwierleeqrtmllsipntgkfggatgnfnahlcaypgvnwldfgelflskyl
glrrqryttqiehydnlaaicdacarlhtilmdlakdvwqyislgyfdqkvragevgvnp
idfenaegnlgmsnavlgflsaklpisrlqrdltdstvlrnlgvplshaliafaslrrgi
dklllnkdviasdlegnwavvaegiqtvlrregypkpyealkvteetvhrfvqqliteev
rqellaitpftyvgytahp

SCOPe Domain Coordinates for d4mx2d_:

Click to download the PDB-style file with coordinates for d4mx2d_.
(The format of our PDB-style files is described here.)

Timeline for d4mx2d_:

  • d4mx2d_ is new in SCOPe 2.07-stable