Lineage for d4moca1 (4moc A:7-153)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944410Species Human (Homo sapiens) [TaxId:9606] [255571] (3 PDB entries)
  8. 2944423Domain d4moca1: 4moc A:7-153 [345351]
    Other proteins in same PDB: d4moca3
    automated match to d5t02f_
    complexed with coa

Details for d4moca1

PDB Entry: 4moc (more details), 2.5 Å

PDB Description: human acyl-coenzyme a thioesterase 12
PDB Compounds: (A:) Acyl-coenzyme A thioesterase 12

SCOPe Domain Sequences for d4moca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4moca1 d.38.1.0 (A:7-153) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gevvmsqaiqpahatargelsagqllkwidttaclaaekhagvscvtasvddiqfeetar
vgqvitikakvtrafstsmeisikvmvqdmltgieklvsvafstfvakpvgkekihlkpv
tllteqdhvehnlaaerrkvrlqhedt

SCOPe Domain Coordinates for d4moca1:

Click to download the PDB-style file with coordinates for d4moca1.
(The format of our PDB-style files is described here.)

Timeline for d4moca1: