SCOPe 2.07: Domain d4ld0b1: 4ld0 B:1-166

Lineage for d4ld0b1 (4ld0 B:1-166)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.6: RuvC resolvase [53134] (2 proteins)
   automatically mapped to Pfam PF02075

6. Protein RuvC resolvase [53135] (2 species)
   Holliday junction-specific endonuclease

7. Species Thermus thermophilus [TaxId:300852] [346310] (3 PDB entries)

8. Domain d4ld0b1: 4ld0 B:1-166 [345336]
   Other proteins in same PDB: d4ld0b2
   protein/DNA complex

Details for d4ld0b1

PDB Entry: 4ld0, 3.75 Å

PDB Description: t. thermophilus ruvc in complex with holliday junction substrate

PDB Compounds: (B:) Crossover junction endodeoxyribonuclease RuvC

SCOPe Domain Sequences for d4ld0b1:

Sequence, based on SEQRES records:

>d4ld0b1 c.55.3.6 (B:1-166) RuvC resolvase {Thermus thermophilus [TaxId: 300852]}
mvvagidpgithlglgvvavegkgalkarllhgevvktspqepakervgriharvlevlh
rfrpeavavqeqffyrqnelaykvgwalgavlvaafeagvpvyaygpmqvkqalaghgha
akeevalmvrgilglkeaprpshladalaialthafyarmgtakpl

Sequence, based on observed residues (ATOM records):

>d4ld0b1 c.55.3.6 (B:1-166) RuvC resolvase {Thermus thermophilus [TaxId: 300852]}
mvvagidpgithlglgvvavlkarllhgevvktspqepakervgriharvlevlhrfrpe
avavqeqffyrqnelaykvgwalgavlvaafeagvpvyaygpmqvkqalaakeevalmvr
gilglkeaprpshladalaialthafyarmgtakpl

Timeline for d4ld0b1:

• d4ld0b1 is new in SCOPe 2.07-stable
  
• d4ld0b1 appears in the current release, SCOPe 2.08