Lineage for d4lctd1 (4lct D:32-324)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2334044Family a.118.8.9: TPR-like repeats from PCI (proteasome / COP9 signalosome / eIF3) domains [345951] (10 protein domains)
    N-terminal part of Pfam PF06272
    Described in PubMed 15180986 as 'HAM (HEAT analagous motif) domain'
    Probably homologous to TPR rather than HEAT, based on PubMed 15790418
  6. 2334045Protein COP9 signalosome complex subunit 1 (CSN1), N-terminal domain [346031] (1 species)
  7. 2334046Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346193] (1 PDB entry)
  8. 2334050Domain d4lctd1: 4lct D:32-324 [345333]
    Other proteins in same PDB: d4lcta2, d4lctb2, d4lctc2, d4lctd2
    complexed with so4

Details for d4lctd1

PDB Entry: 4lct (more details), 2.7 Å

PDB Description: Crystal Structure and Versatile Functional Roles of the COP9 Signalosome Subunit 1
PDB Compounds: (D:) COP9 signalosome complex subunit 1

SCOPe Domain Sequences for d4lctd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lctd1 a.118.8.9 (D:32-324) COP9 signalosome complex subunit 1 (CSN1), N-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
epldieayaalykgrtkimrllfianhcggnhalqfdalrmaydeikkgentqlfrevvn
kignrlgekygmdlawceavdrraeqkkvklenelssyrtnlikesirmgyndfgdfyya
cgmlgdafknyirtrdyctttkhiihmcmnailvsiemgqfthvtsyvnkaeqnpetlep
mvnaklrcasglahlelkkyklaarkfldvnpelgnsyneviapqdiatygglcalasfd
rselkqkvidninfrnflelvpdvrelindfyssryascleylaslksnllld

SCOPe Domain Coordinates for d4lctd1:

Click to download the PDB-style file with coordinates for d4lctd1.
(The format of our PDB-style files is described here.)

Timeline for d4lctd1:

  • d4lctd1 is new in SCOPe 2.07-stable