![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (10 families) ![]() |
![]() | Family a.118.8.9: TPR-like repeats from PCI (proteasome / COP9 signalosome / eIF3) domains [345951] (10 proteins) N-terminal part of Pfam PF06272 Described in PubMed 15180986 as 'HAM (HEAT analagous motif) domain' Probably homologous to TPR rather than HEAT, based on PubMed 15790418 this is a repeat family; one repeat unit is 4cr2 O:123-163 found in domain |
![]() | Protein COP9 signalosome complex subunit 1 (CSN1), N-terminal domain [346031] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346193] (1 PDB entry) |
![]() | Domain d4lctc1: 4lct C:32-324 [345331] Other proteins in same PDB: d4lcta2, d4lctb2, d4lctc2, d4lctd2 complexed with so4 |
PDB Entry: 4lct (more details), 2.7 Å
SCOPe Domain Sequences for d4lctc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lctc1 a.118.8.9 (C:32-324) COP9 signalosome complex subunit 1 (CSN1), N-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} epldieayaalykgrtkimrllfianhcggnhalqfdalrmaydeikkgentqlfrevvn kignrlgekygmdlawceavdrraeqkkvklenelssyrtnlikesirmgyndfgdfyya cgmlgdafknyirtrdyctttkhiihmcmnailvsiemgqfthvtsyvnkaeqnpetlep mvnaklrcasglahlelkkyklaarkfldvnpelgnsyneviapqdiatygglcalasfd rselkqkvidninfrnflelvpdvrelindfyssryascleylaslksnllld
Timeline for d4lctc1: