Lineage for d4lctb2 (4lct B:325-379)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307578Family a.4.5.47: C-terminal part of PCI (proteasome COP9/signalosome eIF3) domains (PINT motif) [109671] (11 proteins)
    Pfam PF01399
    some members have long C-terminal tail with helix
  6. 2307579Protein COP9 signalosome complex subunit 1 (CSN1), C-terminal domain [346012] (1 species)
  7. 2307580Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346156] (1 PDB entry)
  8. 2307582Domain d4lctb2: 4lct B:325-379 [345330]
    Other proteins in same PDB: d4lcta1, d4lctb1, d4lctc1, d4lctd1
    complexed with so4

Details for d4lctb2

PDB Entry: 4lct (more details), 2.7 Å

PDB Description: Crystal Structure and Versatile Functional Roles of the COP9 Signalosome Subunit 1
PDB Compounds: (B:) COP9 signalosome complex subunit 1

SCOPe Domain Sequences for d4lctb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lctb2 a.4.5.47 (B:325-379) COP9 signalosome complex subunit 1 (CSN1), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ihlhdhvdtlydqirkkaliqytlpfvsvdlsrmadafktsvsglekelealitd

SCOPe Domain Coordinates for d4lctb2:

Click to download the PDB-style file with coordinates for d4lctb2.
(The format of our PDB-style files is described here.)

Timeline for d4lctb2: