SCOPe 2.07: Domain d4lctb2: 4lct B:325-379

Lineage for d4lctb2 (4lct B:325-379)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.47: C-terminal part of PCI (proteasome COP9/signalosome eIF3) domains (PINT motif) [109671] (11 proteins)
   Pfam PF01399
   some members have long C-terminal tail with helix

6. Protein COP9 signalosome complex subunit 1 (CSN1), C-terminal domain [346012] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346156] (1 PDB entry)

8. Domain d4lctb2: 4lct B:325-379 [345330]
   Other proteins in same PDB: d4lcta1, d4lctb1, d4lctc1, d4lctd1
   complexed with so4

Details for d4lctb2

PDB Entry: 4lct, 2.7 Å

PDB Description: Crystal Structure and Versatile Functional Roles of the COP9 Signalosome Subunit 1

PDB Compounds: (B:) COP9 signalosome complex subunit 1

SCOPe Domain Sequences for d4lctb2:

Sequence; same for both SEQRES and ATOM records:

>d4lctb2 a.4.5.47 (B:325-379) COP9 signalosome complex subunit 1 (CSN1), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ihlhdhvdtlydqirkkaliqytlpfvsvdlsrmadafktsvsglekelealitd

Timeline for d4lctb2:

• d4lctb2 is new in SCOPe 2.07-stable
  
• d4lctb2 appears in the current release, SCOPe 2.08