Lineage for d1g0rb_ (1g0r B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
  4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (8 families) (S)
  5. 26552Family c.68.1.6: glucose-1-phosphate thymidylyltransferase RmlA [53464] (1 protein)
  6. 26553Protein glucose-1-phosphate thymidylyltransferase RmlA [53465] (1 species)
  7. 26554Species Pseudomonas aeruginosa [TaxId:287] [53466] (7 PDB entries)
  8. 26564Domain d1g0rb_: 1g0r B: [34533]

Details for d1g0rb_

PDB Entry: 1g0r (more details), 1.87 Å

PDB Description: the structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). thymidine/glucose- 1-phosphate complex.

SCOP Domain Sequences for d1g0rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0rb_ c.68.1.6 (B:) glucose-1-phosphate thymidylyltransferase RmlA {Pseudomonas aeruginosa}
krkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdtp
rfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhel
lgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydqq
vvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfiat
lenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy

SCOP Domain Coordinates for d1g0rb_:

Click to download the PDB-style file with coordinates for d1g0rb_.
(The format of our PDB-style files is described here.)

Timeline for d1g0rb_: