Lineage for d4lcta1 (4lct A:32-324)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339718Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2340010Family a.118.8.9: TPR-like repeats from PCI (proteasome / COP9 signalosome / eIF3) domains [345951] (10 proteins)
    N-terminal part of Pfam PF06272
    Described in PubMed 15180986 as 'HAM (HEAT analagous motif) domain'
    Probably homologous to TPR rather than HEAT, based on PubMed 15790418

    this is a repeat family; one repeat unit is 4cr2 O:123-163 found in domain
  6. 2340011Protein COP9 signalosome complex subunit 1 (CSN1), N-terminal domain [346031] (1 species)
  7. 2340012Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346193] (1 PDB entry)
  8. 2340013Domain d4lcta1: 4lct A:32-324 [345327]
    Other proteins in same PDB: d4lcta2, d4lctb2, d4lctc2, d4lctd2
    complexed with so4

Details for d4lcta1

PDB Entry: 4lct (more details), 2.7 Å

PDB Description: Crystal Structure and Versatile Functional Roles of the COP9 Signalosome Subunit 1
PDB Compounds: (A:) COP9 signalosome complex subunit 1

SCOPe Domain Sequences for d4lcta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lcta1 a.118.8.9 (A:32-324) COP9 signalosome complex subunit 1 (CSN1), N-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
epldieayaalykgrtkimrllfianhcggnhalqfdalrmaydeikkgentqlfrevvn
kignrlgekygmdlawceavdrraeqkkvklenelssyrtnlikesirmgyndfgdfyya
cgmlgdafknyirtrdyctttkhiihmcmnailvsiemgqfthvtsyvnkaeqnpetlep
mvnaklrcasglahlelkkyklaarkfldvnpelgnsyneviapqdiatygglcalasfd
rselkqkvidninfrnflelvpdvrelindfyssryascleylaslksnllld

SCOPe Domain Coordinates for d4lcta1:

Click to download the PDB-style file with coordinates for d4lcta1.
(The format of our PDB-style files is described here.)

Timeline for d4lcta1: