Lineage for d4jspa1 (4jsp A:2002-2021,A:2114-2549)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542186Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (2 proteins)
  6. 2542187Protein mTOR kinase domain [346108] (1 species)
  7. 2542188Species Human (Homo sapiens) [TaxId:9606] [346385] (1 PDB entry)
  8. 2542189Domain d4jspa1: 4jsp A:2002-2021,A:2114-2549 [345312]
    Other proteins in same PDB: d4jspa2, d4jspa3
    complexed with ags, mg

Details for d4jspa1

PDB Entry: 4jsp (more details), 3.3 Å

PDB Description: structure of mTORDeltaN-mLST8-ATPgammaS-Mg complex
PDB Compounds: (A:) Serine/threonine-protein kinase mTOR

SCOPe Domain Sequences for d4jspa1:

Sequence, based on SEQRES records: (download)

>d4jspa1 d.144.1.4 (A:2002-2021,A:2114-2549) mTOR kinase domain {Human (Homo sapiens) [TaxId: 9606]}
sntlvqqammvseelirvaiXqlpqltslelqyvspkllmcrdlelavpgtydpnqpiir
iqsiapslqvitskqrprkltlmgsnghefvfllkghedlrqdervmqlfglvntlland
ptslrknlsiqryaviplstnsgligwvphcdtlhalirdyrekkkillniehrimlrma
pdydhltlmqkvevfehavnntagddlakllwlkspssevwfdrrtnytrslavmsmvgy
ilglgdrhpsnlmldrlsgkilhidfgdcfevamtrekfpekipfrltrmltnamevtgl
dgnyritchtvmevlrehkdsvmavleafvydpllnwrlmdtntkgnkrsrtrtdsysag
qsveildgvelgepahkktgttvpesihsfigdglvkpealnkkaiqiinrvrdkltgrd
fshddtldvptqvellikqatshenlcqcyigwcpfw

Sequence, based on observed residues (ATOM records): (download)

>d4jspa1 d.144.1.4 (A:2002-2021,A:2114-2549) mTOR kinase domain {Human (Homo sapiens) [TaxId: 9606]}
sntlvqqammvseelirvaiXqlpqltslelqyvspkllmcrdlelavpgtydpnqpiir
iqsiapslqvitskqrprkltlmgsnghefvfllkghedlrqdervmqlfglvntlland
ptslrknlsiqryaviplstnsgligwvphcdtlhalirdyrekkkillniehrimlrma
pdydhltlmqkvevfehavnntagddlakllwlkspssevwfdrrtnytrslavmsmvgy
ilglgdrhpsnlmldrlsgkilhidfgdcfevamtrekfpekipfrltrmltnamevtgl
dgnyritchtvmevlrehkdsvmavleafvydpllnwrlmdtntalnkkaiqiinrvrdk
ltgrdfshddtldvptqvellikqatshenlcqcyigwcpfw

SCOPe Domain Coordinates for d4jspa1:

Click to download the PDB-style file with coordinates for d4jspa1.
(The format of our PDB-style files is described here.)

Timeline for d4jspa1:

  • d4jspa1 is new in SCOPe 2.07-stable