Lineage for d4it9a_ (4it9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2910051Species Synechococcus sp. [TaxId:32049] [346332] (3 PDB entries)
  8. 2910056Domain d4it9a_: 4it9 A: [345304]
    automated match to d3etfc_
    complexed with edo, po4

Details for d4it9a_

PDB Entry: 4it9 (more details), 1.7 Å

PDB Description: Structure of Bacterial Enzyme
PDB Compounds: (A:) Succinate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d4it9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4it9a_ c.82.1.0 (A:) automated matches {Synechococcus sp. [TaxId: 32049]}
iatinpttgeicqrfkaltpaeidaklakaqeafqayrrtsfsqrrqwlenaaailerdt
skfaeimttemgkthqsaiaeaeksalvcryyaehgeqflaneytetqatesyvcyqplg
illavmpwnfpfwqvfrfaapalmagnvavlkhasnvpqcalaveaileaagfpegvfqt
lligasqveqvikdprvkaatltgsepagaslaslagqeikptllelggsdpfvvfpsad
ldeavevgtvartmnngqsciaakrfilheaiaaefleklhlkfaslkigdpmapetdig
plategilqdisrqvdqavaagakillggrpldragyfypptilteippgakilqeelfa
pvamvftvkdldqaialandipfglgasawtndpaeqqrfiqeldagavfingmvksdpr
lpfggtkrsgygrelglagirtfvnaktvwlk

SCOPe Domain Coordinates for d4it9a_:

Click to download the PDB-style file with coordinates for d4it9a_.
(The format of our PDB-style files is described here.)

Timeline for d4it9a_: