Lineage for d4i43b3 (4i43 B:1653-1838)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459948Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2459949Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2460500Family c.52.1.36: Splicing factor Prp8 endonuclease-like domain [345968] (1 protein)
    Pfam PF10596
    Likely homology to endonuclease domains discussed in PubMed 21441348, PubMed 23354046
  6. 2460501Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [346085] (2 species)
  7. 2460502Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346307] (1 PDB entry)
  8. 2460503Domain d4i43b3: 4i43 B:1653-1838 [345296]
    Other proteins in same PDB: d4i43a1, d4i43a2, d4i43b1, d4i43b2, d4i43b4, d4i43b5
    protein/RNA complex

Details for d4i43b3

PDB Entry: 4i43 (more details), 2 Å

PDB Description: crystal structure of prp8:aar2 complex
PDB Compounds: (B:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d4i43b3:

Sequence, based on SEQRES records: (download)

>d4i43b3 c.52.1.36 (B:1653-1838) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
lwqkihesivfdicqildgeldvlqiesvtketvhprksykmnssaaditmesvhewevs
kpsllhetndsfkglitnkmwfdvqlrygdydshdisryvrakfldyttdnvsmypsptg
vmigidlaynmydaygnwfnglkpliqnsmrtimkanpalyvlrerirkglqiyqssvqe
pflnss

Sequence, based on observed residues (ATOM records): (download)

>d4i43b3 c.52.1.36 (B:1653-1838) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
lwqkihesivfdicqildgeldvlqiesvtketvhprksykmnssaaditmesvhewevs
kpsllhetndsfkglitnkmwfdvqlrygdydshdisryvrakfldyttdnvsmypsptg
vmigidlaynmydaygnwfnglkpliqnsmrtimkanpalyvlrerirkglqiyqepfln
ss

SCOPe Domain Coordinates for d4i43b3:

Click to download the PDB-style file with coordinates for d4i43b3.
(The format of our PDB-style files is described here.)

Timeline for d4i43b3:

  • d4i43b3 is new in SCOPe 2.07-stable