Lineage for d4i43b1 (4i43 B:2147-2396)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489936Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2490288Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2490289Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
    Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
  6. 2490335Protein Splicing factor Prp8 C-terminal domain [267641] (2 species)
  7. 2490336Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346340] (1 PDB entry)
  8. 2490337Domain d4i43b1: 4i43 B:2147-2396 [345294]
    Other proteins in same PDB: d4i43a1, d4i43a2, d4i43b2, d4i43b3, d4i43b4, d4i43b5
    protein/RNA complex

Details for d4i43b1

PDB Entry: 4i43 (more details), 2 Å

PDB Description: crystal structure of prp8:aar2 complex
PDB Compounds: (B:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d4i43b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i43b1 c.97.3.1 (B:2147-2396) Splicing factor Prp8 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ssknewrksaiantllylrlkniyvsaddfveeqnvyvlpknllkkfieisdvkiqvaaf
iygmsakdhpkvkeiktvvlvpqlghvgsvqisnipdigdlpdteglellgwihtqteel
kfmaasevathsklfadkkrdcidisifstpgsvslsaynltdegyqwgeenkdimnvls
egfeptfsthaqlllsdritgnfiipsgnvwnytfmgtafnqegdynfkygiplefynem
hrpvhflqfs

SCOPe Domain Coordinates for d4i43b1:

Click to download the PDB-style file with coordinates for d4i43b1.
(The format of our PDB-style files is described here.)

Timeline for d4i43b1:

  • d4i43b1 is new in SCOPe 2.07-stable