Lineage for d4i43a2 (4i43 A:165-355)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334634Superfamily a.118.29: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345916] (1 family) (S)
    C-terminal part of Pfam PF05282
    Structural similarity with VHS domains (48464) noted in PubMed 21764848, but no compelling evidence of homology
  5. 2334635Family a.118.29.1: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345957] (2 protein domains)
  6. 2334636Protein U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain [346042] (1 species)
  7. 2334637Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346205] (5 PDB entries)
  8. 2334641Domain d4i43a2: 4i43 A:165-355 [345293]
    Other proteins in same PDB: d4i43a1, d4i43b1, d4i43b2, d4i43b3, d4i43b4, d4i43b5
    protein/RNA complex

Details for d4i43a2

PDB Entry: 4i43 (more details), 2 Å

PDB Description: crystal structure of prp8:aar2 complex
PDB Compounds: (A:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d4i43a2:

Sequence, based on SEQRES records: (download)

>d4i43a2 a.118.29.1 (A:165-355) U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
eakneddpahslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgel
qfaflnamffgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdill
nervwniclyssfqknslhntekimenkypellgkdneddaliygisdeerddeddehnp
tivgglyyqrp

Sequence, based on observed residues (ATOM records): (download)

>d4i43a2 a.118.29.1 (A:165-355) U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
eakneddpahslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgel
qfaflnamffgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdill
nervwniclyssfqknslhntekimenkypellgkdnddaliygddeddehnptivggly
yqrp

SCOPe Domain Coordinates for d4i43a2:

Click to download the PDB-style file with coordinates for d4i43a2.
(The format of our PDB-style files is described here.)

Timeline for d4i43a2:

  • d4i43a2 is new in SCOPe 2.07-stable