Lineage for d4i43a1 (4i43 A:2-157)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2413212Fold b.182: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345889] (1 superfamily)
    10-stranded mixed beta sandwich with 3 helices surrounding the upper rim
  4. 2413213Superfamily b.182.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345922] (1 family) (S)
    N-terminal part of Pfam PF05282
  5. 2413214Family b.182.1.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345967] (2 protein domains)
  6. 2413215Protein U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain [346065] (1 species)
  7. 2413216Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346269] (5 PDB entries)
  8. 2413220Domain d4i43a1: 4i43 A:2-157 [345292]
    Other proteins in same PDB: d4i43a2, d4i43b1, d4i43b2, d4i43b3, d4i43b4, d4i43b5
    protein/RNA complex

Details for d4i43a1

PDB Entry: 4i43 (more details), 2 Å

PDB Description: crystal structure of prp8:aar2 complex
PDB Compounds: (A:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d4i43a1:

Sequence, based on SEQRES records: (download)

>d4i43a1 b.182.1.1 (A:2-157) U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywfd
crmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltefv
qmdkirkivrkdenqfsyvdssmttvqenellkssl

Sequence, based on observed residues (ATOM records): (download)

>d4i43a1 b.182.1.1 (A:2-157) U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywfd
crmgnfyiqydpkdglykmmeerdgakfenirqmmvsypkideddtwynltefvqmdkir
kivrkdenqfsyvdssmttvqenellkssl

SCOPe Domain Coordinates for d4i43a1:

Click to download the PDB-style file with coordinates for d4i43a1.
(The format of our PDB-style files is described here.)

Timeline for d4i43a1:

  • d4i43a1 is new in SCOPe 2.07-stable