Lineage for d4i1dc1 (4i1d C:44-364)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915309Species Bradyrhizobium japonicum [TaxId:224911] [346335] (1 PDB entry)
  8. 2915312Domain d4i1dc1: 4i1d C:44-364 [345288]
    Other proteins in same PDB: d4i1da2, d4i1db2, d4i1dc2, d4i1dd2
    automated match to d5l9sb_
    complexed with act, gol, mlt, so4

Details for d4i1dc1

PDB Entry: 4i1d (more details), 2.2 Å

PDB Description: The crystal structure of an ABC transporter substrate-binding protein from Bradyrhizobium japonicum USDA 110
PDB Compounds: (C:) ABC transporter substrate-binding protein

SCOPe Domain Sequences for d4i1dc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i1dc1 c.94.1.0 (C:44-364) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
qitfvsqggayqaaqtvaildpsakklgitinqdsipdawpaiktqvgsgkpiwdvvdtp
tgyclrggeqgliekldfskipnaaampeayrspysvsyefyssvlaysqktfpkdapns
wvdfwdvkkfpgrralrnhpiatleaalmadgvapdklypldvdrafkkleeikphitvw
wtsgaqsaqllndgevdmemawngrvsavakegakvsftynqgilqstslcilkgapnle
tavkflneavdpvhqanlplhidygpgnpkafetnvikperaaqlpsepanaakqalmsy
awwsspageaaekrwasfmqk

SCOPe Domain Coordinates for d4i1dc1:

Click to download the PDB-style file with coordinates for d4i1dc1.
(The format of our PDB-style files is described here.)

Timeline for d4i1dc1: