SCOPe 2.08: Domain d4i1dc1: 4i1d C:44-364

Lineage for d4i1dc1 (4i1d C:44-364)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Bradyrhizobium japonicum [TaxId:224911] [346335] (1 PDB entry)

8. Domain d4i1dc1: 4i1d C:44-364 [345288]
   Other proteins in same PDB: d4i1da2, d4i1db2, d4i1dc2, d4i1dd2
   automated match to d5l9sb_
   complexed with act, gol, mlt, so4

Details for d4i1dc1

PDB Entry: 4i1d, 2.2 Å

PDB Description: The crystal structure of an ABC transporter substrate-binding protein from Bradyrhizobium japonicum USDA 110

PDB Compounds: (C:) ABC transporter substrate-binding protein

SCOPe Domain Sequences for d4i1dc1:

Sequence; same for both SEQRES and ATOM records:

>d4i1dc1 c.94.1.0 (C:44-364) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
qitfvsqggayqaaqtvaildpsakklgitinqdsipdawpaiktqvgsgkpiwdvvdtp
tgyclrggeqgliekldfskipnaaampeayrspysvsyefyssvlaysqktfpkdapns
wvdfwdvkkfpgrralrnhpiatleaalmadgvapdklypldvdrafkkleeikphitvw
wtsgaqsaqllndgevdmemawngrvsavakegakvsftynqgilqstslcilkgapnle
tavkflneavdpvhqanlplhidygpgnpkafetnvikperaaqlpsepanaakqalmsy
awwsspageaaekrwasfmqk

Timeline for d4i1dc1:

• d4i1dc1 first appeared in SCOPe 2.07