Lineage for d4h6oa1 (4h6o A:29-477)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (72 species)
    not a true protein
  7. 2332286Species Trypanosoma cruzi [TaxId:5693] [196511] (19 PDB entries)
  8. 2332305Domain d4h6oa1: 4h6o A:29-477 [345282]
    Other proteins in same PDB: d4h6oa2
    automated match to d4uhia_
    complexed with hem, nee

Details for d4h6oa1

PDB Entry: 4h6o (more details), 2.8 Å

PDB Description: sterol 14-alpha demethylase (cyp51)from trypanosoma cruzi in complex with the inhibitor neu321 (1-(3-(4-chloro-3,5-dimethylphenoxy) benzyl)-1h-imidazole
PDB Compounds: (A:) Sterol 14-alpha demethylase

SCOPe Domain Sequences for d4h6oa1:

Sequence, based on SEQRES records: (download)

>d4h6oa1 a.104.1.0 (A:29-477) automated matches {Trypanosoma cruzi [TaxId: 5693]}
kktppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsr
ffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
evrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmessl
ipaavfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllka
vyrdgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpa
qlnydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllsh
hdeeafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqll
rdevpdpdyhtmvvgptlnqclvkytrkk

Sequence, based on observed residues (ATOM records): (download)

>d4h6oa1 a.104.1.0 (A:29-477) automated matches {Trypanosoma cruzi [TaxId: 5693]}
kktppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsr
ffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
evrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmessl
ipaavfmlpqsarcrearaelqkilgeiivarekesdllggllkavyrdgtrmslhevcg
mivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqlnydnvmdempfae
rcvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhdeeafpnprlwdpe
rdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrdevpdpdyhtmvvg
ptlnqclvkytrkk

SCOPe Domain Coordinates for d4h6oa1:

Click to download the PDB-style file with coordinates for d4h6oa1.
(The format of our PDB-style files is described here.)

Timeline for d4h6oa1:

  • d4h6oa1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4h6oa2