SCOPe 2.08: Domain d4gjtc_: 4gjt C:

Lineage for d4gjtc_ (4gjt C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4gjtc_: 4gjt C: [345281]
   automated match to d5b21a_
   complexed with nag

Details for d4gjtc_

PDB Entry: 4gjt, 3.1 Å

PDB Description: complex structure of nectin-4 bound to mv-h

PDB Compounds: (C:) Poliovirus receptor-related protein 4

SCOPe Domain Sequences for d4gjtc_:

Sequence; same for both SEQRES and ATOM records:

>d4gjtc_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
geletsdvvtvvlgqdaklpcfyrgdsgeqvgqvawarvdagegaqelallhskyglhvs
payegrveqpppprnpldgsvllrnavqadegeyecrvstfpagsfqarlrl

Timeline for d4gjtc_:

• d4gjtc_ first appeared in SCOPe 2.07