Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Streptomyces himastatinicus [TaxId:457427] [346182] (5 PDB entries) |
Domain d4ggva_: 4ggv A: [345279] automated match to d5l94b_ complexed with hem |
PDB Entry: 4ggv (more details), 2.33 Å
SCOPe Domain Sequences for d4ggva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ggva_ a.104.1.0 (A:) automated matches {Streptomyces himastatinicus [TaxId: 457427]} ttvvdrwnihpdhlwlrgqrpespvvfdetqgvwnvygypeamdilndhdtftsdlahll pvsvdapllegdmsqmdpprhrkyrqlvsraftprlvadmetrvaditrelldavdgkpe ieiaadlayplpviviaellgvpagdrdlfkkwaddiiegfsgfsfldtsgqgeqdvrda terlrplldymaghvterrrtpredllthlvqaevdgerltdneivnvanillvtghitt tmtlgntvlcldadpevaakvradrslvpgaieealrvlspsaalargtsrevevagtvi pkdqivmlwlgagnrdprqftdpevydptrdpnphfgfgrgihfclgaplarlegrvaln alfdrfpvlrtdpakpptffptpdmigvntlhlrts
Timeline for d4ggva_: