![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
![]() | Protein automated matches [190543] (131 species) not a true protein |
![]() | Species Rhodobacter sphaeroides [TaxId:272943] [346325] (1 PDB entry) |
![]() | Domain d4ftwa1: 4ftw A:49-267 [345275] Other proteins in same PDB: d4ftwa2 automated match to d5dwda_ complexed with 3cm, cl, na, pin |
PDB Entry: 4ftw (more details), 2.3 Å
SCOPe Domain Sequences for d4ftwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ftwa1 c.69.1.0 (A:49-267) automated matches {Rhodobacter sphaeroides [TaxId: 272943]} mtrkltfgrrgaapgeatslvvflhgygadgadllglaeplaphlpgtafvapdapepcr acgfgfqwfpipwldgssetaaaegmaaaardldafhderlaeeglppealalvgfsqgt mmalhvaprraeeiagivgfsgrllaperlaeearskppvllvhgdadpvvpfadmslag ealaeagfttyghvmkgtghgiapdglsvalaflkerlp
Timeline for d4ftwa1: