SCOPe 2.08: Domain d4ftwa1: 4ftw A:49-267

Lineage for d4ftwa1 (4ftw A:49-267)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:272943] [346325] (1 PDB entry)

8. Domain d4ftwa1: 4ftw A:49-267 [345275]
   Other proteins in same PDB: d4ftwa2
   automated match to d5dwda_
   complexed with 3cm, cl, na, pin

Details for d4ftwa1

PDB Entry: 4ftw, 2.3 Å

PDB Description: Crystal structure of a carboxyl esterase N110C/L145H at 2.3 angstrom resolution

PDB Compounds: (A:) Phospholipase/Carboxylesterase

SCOPe Domain Sequences for d4ftwa1:

Sequence; same for both SEQRES and ATOM records:

>d4ftwa1 c.69.1.0 (A:49-267) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
mtrkltfgrrgaapgeatslvvflhgygadgadllglaeplaphlpgtafvapdapepcr
acgfgfqwfpipwldgssetaaaegmaaaardldafhderlaeeglppealalvgfsqgt
mmalhvaprraeeiagivgfsgrllaperlaeearskppvllvhgdadpvvpfadmslag
ealaeagfttyghvmkgtghgiapdglsvalaflkerlp

Timeline for d4ftwa1:

• d4ftwa1 first appeared in SCOPe 2.07