Lineage for d4fiqc_ (4fiq C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827466Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2827467Protein automated matches [190292] (36 species)
    not a true protein
  7. 2827653Species Pyrococcus horikoshii [TaxId:70601] [346271] (2 PDB entries)
  8. 2827662Domain d4fiqc_: 4fiq C: [345265]
    automated match to d2yzra_

Details for d4fiqc_

PDB Entry: 4fiq (more details), 2.7 Å

PDB Description: crystal structure of pyridoxal biosynthesis lyase pdxs from pyrococcus horikoshii
PDB Compounds: (C:) Pyridoxal biosynthesis lyase pdxS

SCOPe Domain Sequences for d4fiqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fiqc_ c.1.2.0 (C:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
dklkiimekgterlkrgfakmvkggvimdvtnaeqariaeeagavavmalhkvpadirka
ggvarmapvekiqeimdavtipvmakcrigheaearilealgvdmidesevltpadpffh
iykkkftapfvcgarnlgeavrriwegaamirtkgeagtgniieavrhvrlvnenirliq
rmtdeeiygvaekfaepylrlafsvkeisglpkrvlenepiyegftyreivediykille
ikklgrlpvvnfaaggvatpadaalmmamgmdgvfvgsgifkssnppkmaraiveavnhw
depdvlaeisreigepmrgqa

SCOPe Domain Coordinates for d4fiqc_:

Click to download the PDB-style file with coordinates for d4fiqc_.
(The format of our PDB-style files is described here.)

Timeline for d4fiqc_: