Lineage for d4fdhc_ (4fdh C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (68 species)
    not a true protein
  7. 2331745Species Human (Homo sapiens) [TaxId:9606] [196470] (39 PDB entries)
  8. 2331833Domain d4fdhc_: 4fdh C: [345249]
    Other proteins in same PDB: d4fdhe2, d4fdhf2
    automated match to d3na1b_
    complexed with 0t3, hem

Details for d4fdhc_

PDB Entry: 4fdh (more details), 2.71 Å

PDB Description: Structure of human aldosterone synthase, CYP11B2, in complex with fadrozole
PDB Compounds: (C:) Cytochrome P450 11B2, mitochondrial

SCOPe Domain Sequences for d4fdhc_:

Sequence, based on SEQRES records: (download)

>d4fdhc_ a.104.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggprmvcvml
pedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspka
vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
hspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqk
iyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarn
pdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlq
nyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfgmrqclgr
rlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrai

Sequence, based on observed residues (ATOM records): (download)

>d4fdhc_ a.104.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggprmvcvml
pedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspka
vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
hspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqk
iyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarn
pdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlq
nyhipagtlvqvflyslgrnaalfprperynpqrwldfhhvpfgfgmrqclgrrlaeaem
llllhhvlkhflvetltqedikmvysfilrpgtsplltfrai

SCOPe Domain Coordinates for d4fdhc_:

Click to download the PDB-style file with coordinates for d4fdhc_.
(The format of our PDB-style files is described here.)

Timeline for d4fdhc_:

  • d4fdhc_ is new in SCOPe 2.07-stable