SCOPe 2.08: Domain d4eq7a1: 4eq7 A:23-336

Lineage for d4eq7a1 (4eq7 A:23-336)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Agrobacterium fabrum [TaxId:176299] [258501] (12 PDB entries)

8. Domain d4eq7a1: 4eq7 A:23-336 [345238]
   Other proteins in same PDB: d4eq7a2, d4eq7b2
   automated match to d5l9sb_
   complexed with gol, so4

Details for d4eq7a1

PDB Entry: 4eq7, 1.91 Å

PDB Description: Structure of Atu4243-GABA receptor

PDB Compounds: (A:) ABC transporter, substrate binding protein (Polyamine)

SCOPe Domain Sequences for d4eq7a1:

Sequence; same for both SEQRES and ATOM records:

>d4eq7a1 c.94.1.0 (A:23-336) automated matches {Agrobacterium fabrum [TaxId: 176299]}
ndlvfsswggttqdaqkaawaekfmvetginvlqdgptdygklkamveangvtwdvvdve
gdyaaqagpkgllekldfsvidktkldprfvtdysvgsfyysfvigcnvdsvsacpkswa
dlfdtakfpgkrtfykwsapgvieaalladgvtadklypldldrafkkldtiksdiiwws
ggaqsqqliasaeapfgsvwngrmtaleqsgvkvetswaqnitaadslvvpkgtknkdaa
mkfialatsaqaqadmatatgyapvniesaklmdpkiakslpdqqtesqvnadmnywaqh
rdeigerwyawqak

Timeline for d4eq7a1:

• d4eq7a1 first appeared in SCOPe 2.07