Lineage for d4ep5a_ (4ep5 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2494753Family c.55.3.6: RuvC resolvase [53134] (2 proteins)
    automatically mapped to Pfam PF02075
  6. 2494754Protein RuvC resolvase [53135] (2 species)
    Holliday junction-specific endonuclease
  7. 2494760Species Thermus thermophilus [TaxId:300852] [346310] (3 PDB entries)
  8. 2494763Domain d4ep5a_: 4ep5 A: [345237]
    automated match to d4ld0a_
    complexed with gol, so4

Details for d4ep5a_

PDB Entry: 4ep5 (more details), 2.08 Å

PDB Description: Thermus thermophilus RuvC structure
PDB Compounds: (A:) Crossover junction endodeoxyribonuclease RuvC

SCOPe Domain Sequences for d4ep5a_:

Sequence, based on SEQRES records: (download)

>d4ep5a_ c.55.3.6 (A:) RuvC resolvase {Thermus thermophilus [TaxId: 300852]}
mvvagidpgithlglgvvavegkgalkarllhgevvktspqepakervgriharvlevlh
rfrpeavaveeqffyrqnelaykvgwalgavlvaafeagvpvyaygpmqvkqalaghgha
akeevalmvrgilglkeaprpshlanalaialthafyarmgtakpl

Sequence, based on observed residues (ATOM records): (download)

>d4ep5a_ c.55.3.6 (A:) RuvC resolvase {Thermus thermophilus [TaxId: 300852]}
mvvagidpgithlglgvvavegkgalkarllhgevvktspqepakervgriharvlevlh
rfrpeavaveeaykvgwalgavlvaafeagvpvyaygpmqvkqalaghghaakeevalmv
rgilglkeaprpshlanalaialthafyarmgtakpl

SCOPe Domain Coordinates for d4ep5a_:

Click to download the PDB-style file with coordinates for d4ep5a_.
(The format of our PDB-style files is described here.)

Timeline for d4ep5a_: