Lineage for d4ecbb1 (4ecb B:91-226)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2322778Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2322779Protein automated matches [226831] (65 species)
    not a true protein
  7. 2322963Species Human (Homo sapiens) [TaxId:9606] [225003] (12 PDB entries)
  8. 2322986Domain d4ecbb1: 4ecb B:91-226 [345232]
    automated match to d5an1a2

Details for d4ecbb1

PDB Entry: 4ecb (more details), 2.2 Å

PDB Description: chimeric gst containing inserts of kininogen peptides
PDB Compounds: (B:) chimeric protein between GSHKT10 and domain 5 of kininogen-1

SCOPe Domain Sequences for d4ecbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ecbb1 a.45.1.0 (B:91-226) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhp

SCOPe Domain Coordinates for d4ecbb1:

Click to download the PDB-style file with coordinates for d4ecbb1.
(The format of our PDB-style files is described here.)

Timeline for d4ecbb1:

  • d4ecbb1 is new in SCOPe 2.07-stable