SCOPe 2.08: Domain d4ecba1: 4ecb A:91-226

Lineage for d4ecba1 (4ecb A:91-226)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225003] (13 PDB entries)

8. Domain d4ecba1: 4ecb A:91-226 [345231]
   automated match to d5an1a2

Details for d4ecba1

PDB Entry: 4ecb, 2.2 Å

PDB Description: chimeric gst containing inserts of kininogen peptides

PDB Compounds: (A:) chimeric protein between GSHKT10 and domain 5 of kininogen-1

SCOPe Domain Sequences for d4ecba1:

Sequence; same for both SEQRES and ATOM records:

>d4ecba1 a.45.1.0 (A:91-226) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhp

Timeline for d4ecba1:

• d4ecba1 first appeared in SCOPe 2.07