SCOPe 2.06: Domain d1fwyb2: 1fwy B:3-251

Lineage for d1fwyb2 (1fwy B:3-251)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 proteins)

6. Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (3 species)

7. Species Escherichia coli [TaxId:562] [53463] (6 PDB entries)

8. Domain d1fwyb2: 1fwy B:3-251 [34523]
   Other proteins in same PDB: d1fwya1, d1fwyb1
   complexed with edo, so4, ud1

Details for d1fwyb2

PDB Entry: 1fwy, 2.3 Å

PDB Description: crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase bound to udp-glcnac

PDB Compounds: (B:) udp-n-acetylglucosamine pyrophosphorylase

SCOPe Domain Sequences for d1fwyb2:

Sequence; same for both SEQRES and ATOM records:

>d1fwyb2 c.68.1.5 (B:3-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]}
nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll
kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp
qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr
wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse
qaeklllag

Timeline for d1fwyb2:

• d1fwyb2 first appeared (with stable ids) in SCOP 1.55
  
• d1fwyb2 appears in SCOPe 2.05
  
• d1fwyb2 appears in SCOPe 2.07
  
• d1fwyb2 appears in the current release, SCOPe 2.08