Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (14 families) |
Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (2 proteins) |
Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (2 species) |
Species Escherichia coli [TaxId:562] [53463] (3 PDB entries) |
Domain d1fwyb2: 1fwy B:3-251 [34523] Other proteins in same PDB: d1fwya1, d1fwyb1 complexed with edo, so4, ud1 |
PDB Entry: 1fwy (more details), 2.3 Å
SCOP Domain Sequences for d1fwyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fwyb2 c.68.1.5 (B:3-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli} nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse qaeklllag
Timeline for d1fwyb2: