Lineage for d1fwyb2 (1fwy B:3-251)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589782Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 589783Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (14 families) (S)
  5. 589832Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (2 proteins)
  6. 589833Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (2 species)
  7. 589834Species Escherichia coli [TaxId:562] [53463] (3 PDB entries)
  8. 589840Domain d1fwyb2: 1fwy B:3-251 [34523]
    Other proteins in same PDB: d1fwya1, d1fwyb1
    complexed with edo, so4, ud1

Details for d1fwyb2

PDB Entry: 1fwy (more details), 2.3 Å

PDB Description: crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase bound to udp-glcnac

SCOP Domain Sequences for d1fwyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwyb2 c.68.1.5 (B:3-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli}
nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll
kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp
qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr
wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse
qaeklllag

SCOP Domain Coordinates for d1fwyb2:

Click to download the PDB-style file with coordinates for d1fwyb2.
(The format of our PDB-style files is described here.)

Timeline for d1fwyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fwyb1