Lineage for d4dlpc1 (4dlp C:3-352)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469125Species Brucella melitensis [TaxId:359391] [346283] (2 PDB entries)
  8. 2469131Domain d4dlpc1: 4dlp C:3-352 [345214]
    Other proteins in same PDB: d4dlpa2, d4dlpb2, d4dlpc2
    automated match to d2x1la1
    complexed with mse

Details for d4dlpc1

PDB Entry: 4dlp (more details), 2.65 Å

PDB Description: crystal structure of methionyl-trna synthetase metrs from brucella melitensis bound to selenomethionine
PDB Compounds: (C:) Aminoacyl-tRNA synthetase, class I:Aminoacyl-tRNA synthetase, class Ia:Methionyl-tRNA synthetase, class Ia

SCOPe Domain Sequences for d4dlpc1:

Sequence, based on SEQRES records: (download)

>d4dlpc1 c.26.1.0 (C:3-352) automated matches {Brucella melitensis [TaxId: 359391]}
rekyyittaiaypngkphighayeliatdamarfqrlngmdvyfltgtdehgikmlqsar
kegitprdladrntsafrrmaevlnssnddyirtseerhykasqaiwqamvangdiykgg
yagwysvrdeayygeeetevradgvrygpqgtpvewveeesyffrlsayqdklldlyenn
pgfimpaerrneivsfvksglkdlsisrttfdwgipvpgdekhvmyvwvdaltnyitalg
ypdttderwaywpanahiigkdisrfhavywpaflmsaqlplpkrvfahgflfnrgekms
ksvgnvidpfelverygldqlryflmrevpfgqdgsysheaivnrtnadl

Sequence, based on observed residues (ATOM records): (download)

>d4dlpc1 c.26.1.0 (C:3-352) automated matches {Brucella melitensis [TaxId: 359391]}
rekyyittaiaypngkphighayeliatdamarfqrlngmdvyfltgtdehgikmlqsar
kegitprdladrntsafrrmaevlnssnddyirtseerhykasqaiwqamvangdiykgg
yagwysvewveeesyffrlsayqdklldlyennpgfimpaerrneivsfvksglkdlsis
rttfdwgipvpgdekhvmyvwvdaltnyitalgypdttderwaywpanahiigkdisrfh
avywpaflmsaqlplpkrvfahgflfnridpfelverygldqlryflmrevpfgqdgsys
heaivnrtnadl

SCOPe Domain Coordinates for d4dlpc1:

Click to download the PDB-style file with coordinates for d4dlpc1.
(The format of our PDB-style files is described here.)

Timeline for d4dlpc1: