Lineage for d4dlpb2 (4dlp B:353-508)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705920Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2705921Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2705974Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2705975Protein automated matches [226872] (13 species)
    not a true protein
  7. 2705981Species Brucella melitensis [TaxId:359391] [346171] (2 PDB entries)
  8. 2705986Domain d4dlpb2: 4dlp B:353-508 [345213]
    Other proteins in same PDB: d4dlpa1, d4dlpb1, d4dlpc1
    automated match to d2x1la2
    complexed with mse

Details for d4dlpb2

PDB Entry: 4dlp (more details), 2.65 Å

PDB Description: crystal structure of methionyl-trna synthetase metrs from brucella melitensis bound to selenomethionine
PDB Compounds: (B:) Aminoacyl-tRNA synthetase, class I:Aminoacyl-tRNA synthetase, class Ia:Methionyl-tRNA synthetase, class Ia

SCOPe Domain Sequences for d4dlpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dlpb2 a.27.1.0 (B:353-508) automated matches {Brucella melitensis [TaxId: 359391]}
andlgnlaqrslsmiakncegkvpqpgafseadkaildqadaaletarkamddqalhlal
gaifavvaeanryfagqepwalrktdparmgtvlyvtaevlrrvgimvqpfipqsaekll
dilavpadkrqfadvlasplaggtdlpapqpvfpry

SCOPe Domain Coordinates for d4dlpb2:

Click to download the PDB-style file with coordinates for d4dlpb2.
(The format of our PDB-style files is described here.)

Timeline for d4dlpb2: