![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (3 proteins) |
![]() | Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [53463] (6 PDB entries) |
![]() | Domain d1fxjb2: 1fxj B:3-251 [34521] Other proteins in same PDB: d1fxja1, d1fxjb1 complexed with mes, so4 |
PDB Entry: 1fxj (more details), 2.25 Å
SCOPe Domain Sequences for d1fxjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxjb2 c.68.1.5 (B:3-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse qaeklllag
Timeline for d1fxjb2: